Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRX Peptide - C-terminal region

PRX Peptide - C-terminal region

Product Specifications

Product Name Alternative

CMT4F

UniProt

Q9BXM0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRX Rabbit Polyclonal Antibody (orb327383) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRGQEGDAAPKSPVREKSPKFRFPRVSLSPKARSGSGDQEEGGLRVRLPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM53C (NM_001135647) Human Over-expression Lysate
LC427646 20 µg

FAM53C (NM_001135647) Human Over-expression Lysate

Sign In for Pricing
View Details
CD2 (LFA2/600), Biotin conjugate, 0.1mg/mL
BNCB0600-100 1x 100 µL

CD2 (LFA2/600), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Cyanophenylboronic Acid
TRC-C989690-5G 5 g

4-Cyanophenylboronic Acid

Sign In for Pricing
View Details
7-Fluoro-6-nitroquinazolin-4(3H)-one
TRC-F594900-1G 1 g

7-Fluoro-6-nitroquinazolin-4(3H)-one

Sign In for Pricing
View Details
N4BP2L2 Antibody
8C17725-AAT 50 µg

N4BP2L2 Antibody

Sign In for Pricing
View Details
Human CASC5 (KNL1) activation kit by CRISPRa
GA111357 1 Kit

Human CASC5 (KNL1) activation kit by CRISPRa

Sign In for Pricing
View Details