Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEAF6 Peptide - N-terminal region

MEAF6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EAF6, CENP-28, C1orf149, NY-SAR-91

UniProt

Q9HAF1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEAF6 Rabbit Polyclonal Antibody (orb327393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 Antibody
E90761 100 µL

CD34 Antibody

Sign In for Pricing
View Details
Celf3 (NM_172434) Mouse Tagged ORF Clone
MR223509 10 µg

Celf3 (NM_172434) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Bad, phosphorylated (S112) discontinued
340425-01 100 µL

Bad, phosphorylated (S112) discontinued

Sign In for Pricing
View Details
Bad, phosphorylated (S112) discontinued
340425-02 200 µL

Bad, phosphorylated (S112) discontinued

Sign In for Pricing
View Details
ANXA9 Human qPCR Template Standard (NM_003568)
HK209337 1 Kit

ANXA9 Human qPCR Template Standard (NM_003568)

Sign In for Pricing
View Details
Npm2-set siRNA/shRNA/RNAi Lentivector (Rat)
32090096 4x 500 ng

Npm2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details