Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEAF6 Peptide - N-terminal region

MEAF6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EAF6, CENP-28, C1orf149, NY-SAR-91

UniProt

Q9HAF1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEAF6 Rabbit Polyclonal Antibody (orb327393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human ESR1 Polyclonal Antibody, Phospho-Ser167
CPB-638RH 100 ul

Rabbit Anti-Human ESR1 Polyclonal Antibody, Phospho-Ser167

Sign In for Pricing
View Details
OPCA04073-500UG - L1CAM Recombinant Protein (Human)
OPCA04073-500UG 500 µg

OPCA04073-500UG - L1CAM Recombinant Protein (Human)

Sign In for Pricing
View Details
LOC684838 3'UTR Luciferase Stable Cell Line
TU211131 1.0 mL

LOC684838 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
3-Deoxy-3-fluoro-D-galactitol
sc-500612 2.5 mg

3-Deoxy-3-fluoro-D-galactitol

Sign In for Pricing
View Details
Dnmt3L Antibody
E51A05797 100 µL

Dnmt3L Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Stathmin-2/STMN2 Antibody [Alexa Fluor 594]
NBP1-49461AF594 0.1 mL

Rabbit Polyclonal Stathmin-2/STMN2 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details