Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D15 Peptide - C-terminal region

TBC1D15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAB7-GAP

UniProt

Q8TC07

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D15 Rabbit Polyclonal Antibody (orb327394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_073608

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVNRTDRTNKFYEGQDNPGLILLHDILMTYCMYDFDLGYVQGMSDLLSPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA6 CRISPR Knock Out 293T Cell Line (Human)
45232141 1x 10^6 Cells / 1.0 mL

SPATA6 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Giant Sand Timers - 6 Available
1150290/2 1 Each

Giant Sand Timers - 6 Available

Sign In for Pricing
View Details
RRD-251
BA3153-100 100 mg

RRD-251

Sign In for Pricing
View Details
Pig EIF2S1/Eukaryotic translation initiation factor 2 subunit 1 ELISA Kit
MBS2904052-01 48 Well

Pig EIF2S1/Eukaryotic translation initiation factor 2 subunit 1 ELISA Kit

Sign In for Pricing
View Details
Pig EIF2S1/Eukaryotic translation initiation factor 2 subunit 1 ELISA Kit
MBS2904052-02 96 Well

Pig EIF2S1/Eukaryotic translation initiation factor 2 subunit 1 ELISA Kit

Sign In for Pricing
View Details
Pig EIF2S1/Eukaryotic translation initiation factor 2 subunit 1 ELISA Kit
MBS2904052-03 5x 96 Well

Pig EIF2S1/Eukaryotic translation initiation factor 2 subunit 1 ELISA Kit

Sign In for Pricing
View Details