Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D15 Peptide - C-terminal region

TBC1D15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAB7-GAP

UniProt

Q8TC07

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D15 Rabbit Polyclonal Antibody (orb327394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_073608

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVNRTDRTNKFYEGQDNPGLILLHDILMTYCMYDFDLGYVQGMSDLLSPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD122 (CD122 Antigen, High Affinity IL-2 Receptor beta Subunit, Interleukin 2 Receptor beta, Interleukin 2 Receptor Subunit beta, IL-2 Receptor, IL-2RB, IL2RB, OTTHUMP00000028799, P70-75, p75) (MaxLight 405) discontinued
C2460-01K-ML405 100 µL

CD122 (CD122 Antigen, High Affinity IL-2 Receptor beta Subunit, Interleukin 2 Receptor beta, Interleukin 2 Receptor Subunit beta, IL-2 Receptor, IL-2RB, IL2RB, OTTHUMP00000028799, P70-75, p75) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PHKA1 CRISPR Knock Out 293T Cell Line (Human)
36587141 1x 10^6 Cells / 1.0 mL

PHKA1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human Galectin 1 Recombinant
MBS554154-01 0.02 mg

Human Galectin 1 Recombinant

Sign In for Pricing
View Details
Human Galectin 1 Recombinant
MBS554154-02 0.1 mg

Human Galectin 1 Recombinant

Sign In for Pricing
View Details
Human Galectin 1 Recombinant
MBS554154-03 1 mg

Human Galectin 1 Recombinant

Sign In for Pricing
View Details
Human Galectin 1 Recombinant
MBS554154-04 5x 1 mg

Human Galectin 1 Recombinant

Sign In for Pricing
View Details