Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D15 Peptide - C-terminal region

TBC1D15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAB7-GAP

UniProt

Q8TC07

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D15 Rabbit Polyclonal Antibody (orb327394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_073608

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVNRTDRTNKFYEGQDNPGLILLHDILMTYCMYDFDLGYVQGMSDLLSPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Celery seed Extract
C15039 25 mg

Celery seed Extract

Sign In for Pricing
View Details
P53 (Phospho-Ser33) Antibody
ABM0193 100 µL

P53 (Phospho-Ser33) Antibody

Sign In for Pricing
View Details
Galectin-2 (h2) : 293T Lysate
sc-116773 100 µg - 200 µL

Galectin-2 (h2) : 293T Lysate

Sign In for Pricing
View Details
Fto Mouse siRNA Oligo Duplex (Locus ID 26383)
SR416135 1 Kit

Fto Mouse siRNA Oligo Duplex (Locus ID 26383)

Sign In for Pricing
View Details
Seli sgRNA CRISPR Lentivector (Rat) (Target 3)
K7230304 1.0 µg DNA

Seli sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
JWH-007-d11
452917 1 mg

JWH-007-d11

Sign In for Pricing
View Details