TBC1D15 Peptide - C-terminal region
TBC1D15 Peptide - C-terminal region
Product Specifications
Product Name Alternative
RAB7-GAP
UniProt
Q8TC07
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBC1D15 Rabbit Polyclonal Antibody (orb327394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_073608
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DVNRTDRTNKFYEGQDNPGLILLHDILMTYCMYDFDLGYVQGMSDLLSPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M2360-05-ML405 100 µL
MAP Kinase p44/42, CT (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, Mapk, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRKM1 / Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, p44-MAPK, Microtubule-associated Protein 2 Kinase, MNK1, p44-ERK1, ERK1, PRKM3) (MaxLight 405) discontinued
Sign In for Pricing
View Details ELI-31643c 96 Tests
Chicken LIM domain-binding protein 1, LDB1 ELISA KIT
Sign In for Pricing
View Details 
22955121 3x 1.0µg DNA
H2AFZ CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details