Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDAC10 Peptide - C-terminal region

HDAC10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HD10

UniProt

Q969S8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HDAC10 Rabbit Polyclonal Antibody (orb327408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_114408

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SALESIQSARAAQAPHWKSLQQQDVTAVPMSPSSHSPEGRPPPLLPGGPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC25 Polyclonal Antibody
MBS9234402-01 0.1 mL

LRRC25 Polyclonal Antibody

Sign In for Pricing
View Details
LRRC25 Polyclonal Antibody
MBS9234402-02 5x 0.1 mL

LRRC25 Polyclonal Antibody

Sign In for Pricing
View Details
Clonorchis sinensis
Oneq-H811-150D 150 Reactions

Clonorchis sinensis

Sign In for Pricing
View Details
Aarsd1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4970903 1.0 µg DNA

Aarsd1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque MRGPRX3 Protein, His (Fc)-Avi-tagged
MRGPRX3-2648R 50 µg

Recombinant Rhesus Macaque MRGPRX3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Recombinant Mouse Siglec-15 Fc Chimera Protein CF
10101-SL-050 50 µg

Recombinant Mouse Siglec-15 Fc Chimera Protein CF

Sign In for Pricing
View Details