Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KAT8 Peptide - N-terminal region

KAT8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KAT8, MOF, MYST1, PP7073

UniProt

Q9H7Z6

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KAT8 Rabbit Polyclonal Antibody (orb327409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFS1 Antibody
OAEB02113-100UG 100 µg

NDUFS1 Antibody

Sign In for Pricing
View Details
MSH3 Rabbit Polyclonal Antibody (BF750)
orb2414981 100 µL

MSH3 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Casein kinase IIα (m) : 293T Lysate
sc-126578 100 µg - 200 µL

Casein kinase IIα (m) : 293T Lysate

Sign In for Pricing
View Details
Pyrazin-2-Yl-Hydrazine discontinued
287954-01 500 mg

Pyrazin-2-Yl-Hydrazine discontinued

Sign In for Pricing
View Details
Pyrazin-2-Yl-Hydrazine discontinued
287954-02 1 g

Pyrazin-2-Yl-Hydrazine discontinued

Sign In for Pricing
View Details
Pyrazin-2-Yl-Hydrazine discontinued
287954-03 2 g

Pyrazin-2-Yl-Hydrazine discontinued

Sign In for Pricing
View Details