Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KAT8 Peptide - N-terminal region

KAT8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KAT8, MOF, MYST1, PP7073

UniProt

Q9H7Z6

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KAT8 Rabbit Polyclonal Antibody (orb327409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Concisus rpsC Protein (aa 1-232)
VAng-Lsx5892-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Concisus rpsC Protein (aa 1-232)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Protein translocase subunit SecA (secA), partial
MBS1472788 Inquire

Recombinant Shigella dysenteriae serotype 1 Protein translocase subunit SecA (secA), partial

Sign In for Pricing
View Details
HIST3H3 Antibody
orb572454 100 µL

HIST3H3 Antibody

Sign In for Pricing
View Details
Anti-Human MSLN/Mesothelin Antibody (K1), APC
FHG52033 100 Tests

Anti-Human MSLN/Mesothelin Antibody (K1), APC

Sign In for Pricing
View Details
GCS1, CT (Mannosyl-oligosaccharide Glucosidase, Processing A-glucosidase I, MOGS) (Biotin) discontinued
G2023-47A-Biotin 200 µL

GCS1, CT (Mannosyl-oligosaccharide Glucosidase, Processing A-glucosidase I, MOGS) (Biotin) discontinued

Sign In for Pricing
View Details
ONECUT2 Antibody - middle region : FITC (ARP35750_T100-FITC)
ARP35750_T100-FITC 100 µL

ONECUT2 Antibody - middle region : FITC (ARP35750_T100-FITC)

Sign In for Pricing
View Details