Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEX3D Peptide - middle region

MEX3D Peptide - middle region

Product Specifications

Product Name Alternative

MEX3D, KIAA2031, RKHD1, RNF193

UniProt

Q86XN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEX3D Rabbit Polyclonal Antibody (orb588550) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_976049

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFA

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3GAT1 Antibody
MBS8590818-01 0.1 mg

B3GAT1 Antibody

Sign In for Pricing
View Details
B3GAT1 Antibody
MBS8590818-02 0.1 mL (AF405L)

B3GAT1 Antibody

Sign In for Pricing
View Details
B3GAT1 Antibody
MBS8590818-03 0.1 mL (AF405S)

B3GAT1 Antibody

Sign In for Pricing
View Details
B3GAT1 Antibody
MBS8590818-04 0.1 mL (AF610)

B3GAT1 Antibody

Sign In for Pricing
View Details
B3GAT1 Antibody
MBS8590818-05 0.1 mL (AF635)

B3GAT1 Antibody

Sign In for Pricing
View Details
B3GAT1 Antibody
MBS8590818-06 0.1 mL (APC)

B3GAT1 Antibody

Sign In for Pricing
View Details