MEX3D Peptide - middle region
MEX3D Peptide - middle region
Product Specifications
Product Name Alternative
MEX3D, KIAA2031, RKHD1, RNF193
UniProt
Q86XN8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MEX3D Rabbit Polyclonal Antibody (orb588550) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_976049
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFA
More Discoveries
Explore Other Products
Browse additional items from our catalog
23309141 1x 10^6 Cells / 1.0 mL
HIST1H1PS1 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details G2699 96 Tests
Protein disulfide-isomerase TMX3 (TMX3) Mouse ELISA Kit
Sign In for Pricing
View Details