Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTN1 Peptide - N-terminal region

ACTN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACTN1

UniProt

P12814

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTN1 Rabbit Polyclonal Antibody (orb588552) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lysyl tRNA synthetase (KARS) (NM_001130089) Human Tagged ORF Clone
RG226041 10 µg

Lysyl tRNA synthetase (KARS) (NM_001130089) Human Tagged ORF Clone

Sign In for Pricing
View Details
Annexin A10 Overexpression Lysate (Native) - (Dry Ice)
NBL1-07558 0.1 mg

Annexin A10 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Lentiviral mouse Hddc3 shRNA (UAS) - Lentiviral mouse Hddc3 shRNA (UAS, iRFP) plasmid
GTR15245224 1 Vial

Lentiviral mouse Hddc3 shRNA (UAS) - Lentiviral mouse Hddc3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PIGP Polyclonal Antibody
E915446 100 µL

PIGP Polyclonal Antibody

Sign In for Pricing
View Details
Cluster of Differentiation 30 Ligand (CD30L) Rat ELISA Kit
C2306 96 Tests

Cluster of Differentiation 30 Ligand (CD30L) Rat ELISA Kit

Sign In for Pricing
View Details
Blood Group A trisaccharide, N-aminoethyl nonanamide
OB07522-01 500 µg

Blood Group A trisaccharide, N-aminoethyl nonanamide

Sign In for Pricing
View Details