Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2B Peptide - C-terminal region

ACVR2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

HTX4, ACTRIIB, ActR-IIB

UniProt

Q13705

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACVR2B Rabbit Polyclonal Antibody (orb327418) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001097

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus
MBS206309-01 0.01 mg

Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus

Sign In for Pricing
View Details
Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus
MBS206309-02 0.05 mg

Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus

Sign In for Pricing
View Details
Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus
MBS206309-03 5x 0.01 mg

Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus

Sign In for Pricing
View Details
Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus
MBS206309-04 0.25 mg

Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus

Sign In for Pricing
View Details
Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus
MBS206309-05 5x 0.05 mg

Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus

Sign In for Pricing
View Details
Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus
MBS206309-06 5x 0.25 mg

Tumor necrosis factor receptor superfamily member 17, 1-54aa, Human, hIgG-His tag, Baculovirus

Sign In for Pricing
View Details