Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2B Peptide - C-terminal region

ACVR2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

HTX4, ACTRIIB, ActR-IIB

UniProt

Q13705

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACVR2B Rabbit Polyclonal Antibody (orb327418) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001097

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HS-27
BA4198-5.1 1 mL (10 mM in DMSO)

HS-27

Sign In for Pricing
View Details
Lentiviral human CCNB2 shRNA (UAS) - Lentiviral human CCNB2 shRNA (UAS, iRFP) (100)
GTR15159351 1 Vial

Lentiviral human CCNB2 shRNA (UAS) - Lentiviral human CCNB2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Human FAM20B MAb (Clone 1018524)
MAB84271-SP 25 µg

Human FAM20B MAb (Clone 1018524)

Sign In for Pricing
View Details
Toll/interleukin-1 receptor domain-containing adapter protein
orb1636314-01 50 µg

Toll/interleukin-1 receptor domain-containing adapter protein

Sign In for Pricing
View Details
Toll/interleukin-1 receptor domain-containing adapter protein
orb1636314-02 100 µg

Toll/interleukin-1 receptor domain-containing adapter protein

Sign In for Pricing
View Details
Toll/interleukin-1 receptor domain-containing adapter protein
orb1636314-03 1 mg

Toll/interleukin-1 receptor domain-containing adapter protein

Sign In for Pricing
View Details