Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACY1 Peptide - middle region

ACY1 Peptide - middle region

Product Specifications

Product Name Alternative

ACY1

UniProt

Q03154

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACY1 Rabbit Polyclonal Antibody (orb588553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001185827

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Anti-Cyclophilin A (CYPA)
FY-AB43820-01 1 mL

FITC-Linked Anti-Cyclophilin A (CYPA)

Sign In for Pricing
View Details
FITC-Linked Anti-Cyclophilin A (CYPA)
FY-AB43820-02 100 µL

FITC-Linked Anti-Cyclophilin A (CYPA)

Sign In for Pricing
View Details
FITC-Linked Anti-Cyclophilin A (CYPA)
FY-AB43820-03 200 µL

FITC-Linked Anti-Cyclophilin A (CYPA)

Sign In for Pricing
View Details
Mouse Forkhead box protein J2 (FOXJ2) ELISA Kit
MBS2800127-01 48 Tests

Mouse Forkhead box protein J2 (FOXJ2) ELISA Kit

Sign In for Pricing
View Details
Mouse Forkhead box protein J2 (FOXJ2) ELISA Kit
MBS2800127-02 96 Tests

Mouse Forkhead box protein J2 (FOXJ2) ELISA Kit

Sign In for Pricing
View Details
Mouse Forkhead box protein J2 (FOXJ2) ELISA Kit
MBS2800127-03 5x 96 Tests

Mouse Forkhead box protein J2 (FOXJ2) ELISA Kit

Sign In for Pricing
View Details