Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCYAP1R1 Peptide - N-terminal region

ADCYAP1R1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAC1, PAC1R, PACAPR, PACAPRI

UniProt

P41586

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADCYAP1R1 Rabbit Polyclonal Antibody (orb327419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEM With Earle's Salts , with L-glutamine
CM044-350 50x 500 mL

MEM With Earle's Salts , with L-glutamine

Sign In for Pricing
View Details
Lymphoma, Hodgkins Disease Membrane Tumor Lysate
orb1672414 0.1 mg

Lymphoma, Hodgkins Disease Membrane Tumor Lysate

Sign In for Pricing
View Details
Collagen Type VI antibody (biotin)
60R-CR006bt 100 µg

Collagen Type VI antibody (biotin)

Sign In for Pricing
View Details
MYLK-AS2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV735687 1.0 µg DNA

MYLK-AS2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Mouse Monoclonal AlphaB Crystallin/CRYAB Antibody (CRYAB/4661) [DyLight 488]
NBP3-21137G 0.1 mL

Mouse Monoclonal AlphaB Crystallin/CRYAB Antibody (CRYAB/4661) [DyLight 488]

Sign In for Pricing
View Details
DAAM1 (WW-3) : m-IgG Fc BP-HRP Bundle
sc-537294 1 Kit

DAAM1 (WW-3) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details