Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCYAP1R1 Peptide - N-terminal region

ADCYAP1R1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAC1, PAC1R, PACAPR, PACAPRI

UniProt

P41586

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADCYAP1R1 Rabbit Polyclonal Antibody (orb327419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myoglobin Ready-To-Use IHC Kit
orb2819080 50 Tests

Human Myoglobin Ready-To-Use IHC Kit

Sign In for Pricing
View Details
Bovine Prostaglandin F ELISA kit
GTR10425079 96 Well

Bovine Prostaglandin F ELISA kit

Sign In for Pricing
View Details
ADCY5 Polyclonal Antibody, Biotin Conjugated
bs-3922R-Biotin-TR 20 µL

ADCY5 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Vetiveria Zizanioides Extract
C02991 5 mg

Vetiveria Zizanioides Extract

Sign In for Pricing
View Details
FCRL1 (NM_001159397) Human Tagged Lenti ORF Clone
RC228294L3 10 µg

FCRL1 (NM_001159397) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PARP12 AAV siRNA Pooled Vector
36025161 1.0 µg

PARP12 AAV siRNA Pooled Vector

Sign In for Pricing
View Details