Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP1B1 Peptide - C-terminal region

AP1B1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AP1B1, ADTB1, BAM22, CLAPB2

UniProt

Q10567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP1B1 Rabbit Polyclonal Antibody (orb331499) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanin Concentrating Hormone Receptor 1 (MCH Receptor 1, MCHR1, MCH-R1, MCHR-1, MCH1R, MCH-1R, MCHR, G-Protein Coupled Receptor 24, GPR24, GPCR MCH1, GPCR SLC/MCH1, MGC32129, Somatostatin Receptor-like Protein, SLC1, SLC-1) (Azide Free) (MaxLight 550)
M2867-75F-ML550 100 µL

Melanin Concentrating Hormone Receptor 1 (MCH Receptor 1, MCHR1, MCH-R1, MCHR-1, MCH1R, MCH-1R, MCHR, G-Protein Coupled Receptor 24, GPR24, GPCR MCH1, GPCR SLC/MCH1, MGC32129, Somatostatin Receptor-like Protein, SLC1, SLC-1) (Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Mouse HP protein (His tag)
MBS2580859-01 0.02 mg

Recombinant Mouse HP protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse HP protein (His tag)
MBS2580859-02 0.1 mg

Recombinant Mouse HP protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse HP protein (His tag)
MBS2580859-03 5x 0.1 mg

Recombinant Mouse HP protein (His tag)

Sign In for Pricing
View Details
Reagecon Lead Standard for Atomic Absorption (AAS) 1000 μg/mL (1000 ppm) in 0.5M Nitric Acid (HNO3)
AAPBH 500 mL

Reagecon Lead Standard for Atomic Absorption (AAS) 1000 μg/mL (1000 ppm) in 0.5M Nitric Acid (HNO3)

Sign In for Pricing
View Details
BLZF1 Rabbit Polyclonal Antibody (HRP)
orb2082872 100 µL

BLZF1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details