Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP1B1 Peptide - C-terminal region

AP1B1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AP1B1, ADTB1, BAM22, CLAPB2

UniProt

Q10567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP1B1 Rabbit Polyclonal Antibody (orb331499) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mydgf (Myeloid-derived growth factor) ELISA Kit
MBS7615438-01 48 Well

Mouse Mydgf (Myeloid-derived growth factor) ELISA Kit

Sign In for Pricing
View Details
Mouse Mydgf (Myeloid-derived growth factor) ELISA Kit
MBS7615438-02 96 Well

Mouse Mydgf (Myeloid-derived growth factor) ELISA Kit

Sign In for Pricing
View Details
Mouse Mydgf (Myeloid-derived growth factor) ELISA Kit
MBS7615438-03 5x 96 Well

Mouse Mydgf (Myeloid-derived growth factor) ELISA Kit

Sign In for Pricing
View Details
Mouse Mydgf (Myeloid-derived growth factor) ELISA Kit
MBS7615438-04 10x 96 Well

Mouse Mydgf (Myeloid-derived growth factor) ELISA Kit

Sign In for Pricing
View Details
HGP153 full length protein-synthetic nanodisc
orb2707844-01 10 µg

HGP153 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
HGP153 full length protein-synthetic nanodisc
orb2707844-02 50 µg

HGP153 full length protein-synthetic nanodisc

Sign In for Pricing
View Details