Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH1A3 Peptide - N-terminal region

ALDH1A3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALDH6, MCOP8, RALDH3, ALDH1A6

UniProt

P47895

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH1A3 Rabbit Polyclonal Antibody (orb327421) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KP6 Killer Toxin (FITC)
566689-01 50 µg

KP6 Killer Toxin (FITC)

Sign In for Pricing
View Details
KP6 Killer Toxin (FITC)
566689-02 100 µg

KP6 Killer Toxin (FITC)

Sign In for Pricing
View Details
WAP Lentiviral Activation Particles (m)
sc-423691-LAC 200 µL

WAP Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
POMT1 Polyclonal Antibody, Cy5.5 Conjugated
bs-5952R-Cy5.5 100 µL

POMT1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Chicken Leptin receptor (LEPR) ELISA Kit
MBS7235881-01 48 Well

Chicken Leptin receptor (LEPR) ELISA Kit

Sign In for Pricing
View Details
Chicken Leptin receptor (LEPR) ELISA Kit
MBS7235881-02 96 Well

Chicken Leptin receptor (LEPR) ELISA Kit

Sign In for Pricing
View Details