Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3A2 Peptide - C-terminal region

ALDH3A2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SLS, FALDH, ALDH10

UniProt

P51648

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH3A2 Rabbit Polyclonal Antibody (orb327422) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromopropane
TRC-B687190-50G 50 g

2-Bromopropane

Sign In for Pricing
View Details
Hamartin (TSC1) (NM_000368) Human Over-expression Lysate
LC400132 20 µg

Hamartin (TSC1) (NM_000368) Human Over-expression Lysate

Sign In for Pricing
View Details
TrkB (NTRK2) (NM_006180) Human Recombinant Protein
TP321794M 100 µg

TrkB (NTRK2) (NM_006180) Human Recombinant Protein

Sign In for Pricing
View Details
RAB25 Polyclonal Antibody
E-AB-12234-01 20 µL

RAB25 Polyclonal Antibody

Sign In for Pricing
View Details
RAB25 Polyclonal Antibody
E-AB-12234-02 60 µL

RAB25 Polyclonal Antibody

Sign In for Pricing
View Details
RAB25 Polyclonal Antibody
E-AB-12234-03 120 µL

RAB25 Polyclonal Antibody

Sign In for Pricing
View Details