Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3A2 Peptide - C-terminal region

ALDH3A2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SLS, FALDH, ALDH10

UniProt

P51648

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH3A2 Rabbit Polyclonal Antibody (orb327422) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), 0.2mg/mL
BNUB0531-500 1x 500 µL

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), 0.2mg/mL

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF740 conjugate, 0.1mg/mL
BNC740896-100 1x 100 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AGA (NM_000027) Human Over-expression Lysate
LY424971 100 µg

AGA (NM_000027) Human Over-expression Lysate

Sign In for Pricing
View Details
CRKL pTyr207 Rabbit Polyclonal Antibody
AP20935PU-N 100 µg

CRKL pTyr207 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Apogossypolone
TRC-A727400-25MG 25 mg

Apogossypolone

Sign In for Pricing
View Details
SLC6A12 (NM_001122847) Human Over-expression Lysate
LC426578 20 µg

SLC6A12 (NM_001122847) Human Over-expression Lysate

Sign In for Pricing
View Details