Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA2 Peptide - N-terminal region

ANXA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ANXA2, ANX2, ANX2L4, CAL1H, LPC2D

UniProt

P07355

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANXA2 Rabbit Polyclonal Antibody (orb331500) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004030

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1E1 (V-type Proton ATPase Subunit E 1, V-ATPase Subunit E 1, V-ATPase 31kD Subunit, p31, Vacuolar Proton Pump Subunit E 1, ATP6E, ATP6E2) (Biotin)
123733-Biotin 100 µL

ATP6V1E1 (V-type Proton ATPase Subunit E 1, V-ATPase Subunit E 1, V-ATPase 31kD Subunit, p31, Vacuolar Proton Pump Subunit E 1, ATP6E, ATP6E2) (Biotin)

Sign In for Pricing
View Details
Human Vacuolating cytotoxin A IgG (VacA-IgG) ELISA Kit
YP-W13073-01 48 Tests

Human Vacuolating cytotoxin A IgG (VacA-IgG) ELISA Kit

Sign In for Pricing
View Details
Human Vacuolating cytotoxin A IgG (VacA-IgG) ELISA Kit
YP-W13073-02 96 Tests

Human Vacuolating cytotoxin A IgG (VacA-IgG) ELISA Kit

Sign In for Pricing
View Details
DCAF8L1 (NM_001017930) Human Tagged ORF Clone Lentiviral Particle
RC220603L3V 200 µL

DCAF8L1 (NM_001017930) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Drosophila pseudoobscura pseudoobscura AF4/FMR2 family member 4 (lilli), partial
MBS1462614 Inquire

Recombinant Drosophila pseudoobscura pseudoobscura AF4/FMR2 family member 4 (lilli), partial

Sign In for Pricing
View Details
Prph2 siRNA Oligos set (Mouse)
37770174 3x 5 nmol

Prph2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details