Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA2 Peptide - N-terminal region

ANXA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ANXA2, ANX2, ANX2L4, CAL1H, LPC2D

UniProt

P07355

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANXA2 Rabbit Polyclonal Antibody (orb331500) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004030

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FAM9B sgRNA gene knockout kit - Lentiviral human FAM9B sgRNA gene knockout kit (100)
GTR15375271 1 Vial

Lentiviral human FAM9B sgRNA gene knockout kit - Lentiviral human FAM9B sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
FSH beta (FSHB) Mouse Monoclonal Antibody [Clone ID: LBI4E10]
AMM10195VCF 100 µg

FSH beta (FSHB) Mouse Monoclonal Antibody [Clone ID: LBI4E10]

Sign In for Pricing
View Details
Phospho-Histone H3 (Ser10) rabbit mAb APC conjugate Antibody
orb1946300-01 10 Tests

Phospho-Histone H3 (Ser10) rabbit mAb APC conjugate Antibody

Sign In for Pricing
View Details
Phospho-Histone H3 (Ser10) rabbit mAb APC conjugate Antibody
orb1946300-02 100 Tests

Phospho-Histone H3 (Ser10) rabbit mAb APC conjugate Antibody

Sign In for Pricing
View Details
Recombinant Mouse CPS1 Protein, His (Fc)-Avi-tagged
CPS1-1941M 50 µg

Recombinant Mouse CPS1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Apbb2 Mouse Gene Knockout Kit (CRISPR)
KN501385 1 Kit

Apbb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details