Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APBB1 Peptide - N-terminal region

APBB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

APBB1, FE65, RIR

UniProt

O00213

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APBB1 Rabbit Polyclonal Antibody (orb588560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadherin E (Cadherin-1, CAM 120/80, Epithelial Cadherin, E-cadherin, Uvomorulin, CD324, CDH1, CDHE, UVO) (MaxLight 550)
124232-ML550 100 µL

Cadherin E (Cadherin-1, CAM 120/80, Epithelial Cadherin, E-cadherin, Uvomorulin, CD324, CDH1, CDHE, UVO) (MaxLight 550)

Sign In for Pricing
View Details
AP1M2 Rabbit Polyclonal Antibody (Cy7)
orb1062530 100 µL

AP1M2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
SSX5 Human Gene Knockout Kit (CRISPR)
KN402208 1 Kit

SSX5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Bovine Protein canopy homolog 4 (CNPY4)
MBS1456938-01 0.02 mg (E-Coli)

Recombinant Bovine Protein canopy homolog 4 (CNPY4)

Sign In for Pricing
View Details
Recombinant Bovine Protein canopy homolog 4 (CNPY4)
MBS1456938-02 0.1 mg (E-Coli)

Recombinant Bovine Protein canopy homolog 4 (CNPY4)

Sign In for Pricing
View Details
Recombinant Bovine Protein canopy homolog 4 (CNPY4)
MBS1456938-03 0.02 mg (Yeast)

Recombinant Bovine Protein canopy homolog 4 (CNPY4)

Sign In for Pricing
View Details