Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APBB1 Peptide - N-terminal region

APBB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

APBB1, FE65, RIR

UniProt

O00213

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APBB1 Rabbit Polyclonal Antibody (orb588560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAT1 Rabbit pAb
E2164006 100 µL

GNAT1 Rabbit pAb

Sign In for Pricing
View Details
EZ-Rate ESR pipettes
3481 800/CS

EZ-Rate ESR pipettes

Sign In for Pricing
View Details
FZD discontinued
400397-01 50 µL

FZD discontinued

Sign In for Pricing
View Details
FZD discontinued
400397-02 100 µL

FZD discontinued

Sign In for Pricing
View Details
SEZ6L2 (NM_201575) Human Tagged Lenti ORF Clone
RC220064L1 10 µg

SEZ6L2 (NM_201575) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NHLRC2 AAV Vector (Rat) (CMV)
31812106 1 µg

NHLRC2 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details