ARHGAP5 Peptide - C-terminal region
ARHGAP5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GFI2, p190-B, RhoGAP5, p190BRhoGAP
UniProt
Q13017
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARHGAP5 Rabbit Polyclonal Antibody (orb327426) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_005267693
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YLSDNTRESTHQSEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-ITIH2-Hu-01 96 Tests
Human Inter-alpha-trypsin inhibitor heavy chain H2 (ITIH2) ELISA Kit
Sign In for Pricing
View Details