ATP5F1C Peptide - N-terminal region
ATP5F1C Peptide - N-terminal region
Product Specifications
Product Name Alternative
ATP5C, ATP5C1, ATP5CL1
UniProt
P36542
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATP5F1C Rabbit Polyclonal Antibody (orb588563) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVATLTA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740012-100 1x 100 µL
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400012-100 1x 100 µL
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740204-500 1x 500 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881037-500 1x 500 µL
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details