Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BIK Peptide - N-terminal region

BIK Peptide - N-terminal region

Product Specifications

Product Name Alternative

BIK, NBK

UniProt

Q13323

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BIK Rabbit Polyclonal Antibody (orb588564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001188

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NeuN Rabbit Monoclonal Antibody
AMRe86217-01 1 Each

NeuN Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NeuN Rabbit Monoclonal Antibody
AMRe86217-02 50 µL

NeuN Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NeuN Rabbit Monoclonal Antibody
AMRe86217-03 100 µL

NeuN Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CAPN1 Polyclonal Antibody
E-AB-65834-01 60 µL

CAPN1 Polyclonal Antibody

Sign In for Pricing
View Details
CAPN1 Polyclonal Antibody
E-AB-65834-02 120 µL

CAPN1 Polyclonal Antibody

Sign In for Pricing
View Details
CAPN1 Polyclonal Antibody
E-AB-65834-03 200 µL

CAPN1 Polyclonal Antibody

Sign In for Pricing
View Details