SERPINA6 Peptide - middle region
SERPINA6 Peptide - middle region
Product Specifications
Product Name Alternative
CBG
UniProt
P08185
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SERPINA6 Rabbit Polyclonal Antibody (orb588568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001747
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LVP460-Bsd 1 x 10^7 IFU/mL - 200 µL
LoxP GFP/RFP ColorSwitch (Bsd) lentivirus
Sign In for Pricing
View Details 
K0587704 1.0 µg DNA
DFNA34 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details