SERPINA6 Peptide - middle region
SERPINA6 Peptide - middle region
Product Specifications
Product Name Alternative
CBG
UniProt
P08185
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SERPINA6 Rabbit Polyclonal Antibody (orb588568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001747
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10420769 96 Well
Porcine Suppressor of tumorigenicity 7 protein (ST7) ELISA kit
Sign In for Pricing
View Details MBS1320064-01 0.02 mg (E-Coli)
Recombinant Dog Apoptotic protease-activating factor 1 (APAF1)
Sign In for Pricing
View Details MBS1320064-02 0.1 mg (E-Coli)
Recombinant Dog Apoptotic protease-activating factor 1 (APAF1)
Sign In for Pricing
View Details MBS1320064-03 0.02 mg (Yeast)
Recombinant Dog Apoptotic protease-activating factor 1 (APAF1)
Sign In for Pricing
View Details