Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRM3 Peptide - C-terminal region

CHRM3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HM3, PBS, EGBRS

UniProt

P20309

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRM3 Rabbit Polyclonal Antibody (orb327435) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006711795

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK2 (MAPK9) (NM_002752) Human Recombinant Protein
TP312814 20 µg

JNK2 (MAPK9) (NM_002752) Human Recombinant Protein

Sign In for Pricing
View Details
MMP3 (NM_002422) Human Recombinant Protein
TP310235M 100 µg

MMP3 (NM_002422) Human Recombinant Protein

Sign In for Pricing
View Details
HIP1R Rabbit Polyclonal Antibody
TA361113 100 µL

HIP1R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ECE1 Rabbit Polyclonal Antibody
AP17300PU-N 400 µL

ECE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), Biotin conjugate, 0.1mg/mL
BNCB2467-500 1x 500 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF405S conjugate, 0.1mg/mL
BNC042290-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details