Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRM3 Peptide - C-terminal region

CHRM3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HM3, PBS, EGBRS

UniProt

P20309

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRM3 Rabbit Polyclonal Antibody (orb327435) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006711795

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multistation Stirrer BMSS-102
BMSS-102 1 Unit

Multistation Stirrer BMSS-102

Sign In for Pricing
View Details
1-Hexyl-2-phenyl-4-(1-naphthoyl)pyrroleJWH-147
TRC-H297400-5MG 5 mg

1-Hexyl-2-phenyl-4-(1-naphthoyl)pyrroleJWH-147

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), 0.2mg/mL
BNUB2363-100 1x 100 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), 0.2mg/mL

Sign In for Pricing
View Details
PCCA (NM_001178004) Human Over-expression Lysate
LC433422 20 µg

PCCA (NM_001178004) Human Over-expression Lysate

Sign In for Pricing
View Details
ACP1 Antibody
KC-7494-01 50 μL

ACP1 Antibody

Sign In for Pricing
View Details
ACP1 Antibody
KC-7494-02 100 µL

ACP1 Antibody

Sign In for Pricing
View Details