Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKB Peptide - N-terminal region

CKB Peptide - N-terminal region

Product Specifications

Product Name Alternative

BCK, B-CK, CKBB, CPK-B, HEL-211, HEL-S-29

UniProt

P12277

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKB Rabbit Polyclonal Antibody (orb327436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001814

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEPT1 (N-term) Rabbit Polyclonal Antibody
AP50865PU-N 400 µL

CEPT1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Golgi Complex (371-4), CF647 conjugate, 0.1mg/mL
BNC470102-500 1x 500 µL

Golgi Complex (371-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Turbidity Meter BMET-702
BMET-702 1 Unit

Turbidity Meter BMET-702

Sign In for Pricing
View Details
LysoViewTM 650, 1000X IN DMSO
#70059 1x 50 µL

LysoViewTM 650, 1000X IN DMSO

Sign In for Pricing
View Details
Dynamin 2 (DNM2) Human Gene Knockout Kit (CRISPR)
KN208525LP 1 Kit

Dynamin 2 (DNM2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tnk2 Mouse Gene Knockout Kit (CRISPR)
KN518010 1 Kit

Tnk2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details