Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKS1B Peptide - N-terminal region

CKS1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

CKS1, ckshs1, PNAS-16, PNAS-18

UniProt

P61024

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKS1B Rabbit Polyclonal Antibody (orb588571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001817

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPAAT-η CRISPR/Cas9 KO Plasmid (h2)
sc-406893-KO-2 20 µg

LPAAT-η CRISPR/Cas9 KO Plasmid (h2)

Sign In for Pricing
View Details
CASP10
557410-01 50 µg

CASP10

Sign In for Pricing
View Details
CASP10
557410-02 100 µg

CASP10

Sign In for Pricing
View Details
0610010K14Rik Protein Vector (Mouse) (pPB-N-His)
PV146171 500 ng

0610010K14Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
EHMT2/G9A (EHMT2) (NM_001289413) Human Tagged ORF Clone
RC240065 10 µg

EHMT2/G9A (EHMT2) (NM_001289413) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Inducible T-Cell Co Stimulator ELISA Kit
MBS083054 Inquire

Rabbit Inducible T-Cell Co Stimulator ELISA Kit

Sign In for Pricing
View Details