Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCN5 Peptide - N-terminal region

CLCN5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLCN5, CLCK2

UniProt

P51795

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLCN5 Rabbit Polyclonal Antibody (orb588573) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFLEEPIPGVGTYDDFNTIDWVREKSRDRDRHREITNKSKESTWALIHSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M/M053/NT/ALU-DIA100-1 Personal Protection (PPE) Signs (No Adhesive)
238767 1 Pack (1 Panel (s) x 1 Pack)

M/M053/NT/ALU-DIA100-1 Personal Protection (PPE) Signs (No Adhesive)

Sign In for Pricing
View Details
WWOX(Phospho Tyr33) Polyclonal Antibody
JOT-AP15561-01 20 µL

WWOX(Phospho Tyr33) Polyclonal Antibody

Sign In for Pricing
View Details
WWOX(Phospho Tyr33) Polyclonal Antibody
JOT-AP15561-02 50 μL

WWOX(Phospho Tyr33) Polyclonal Antibody

Sign In for Pricing
View Details
WWOX(Phospho Tyr33) Polyclonal Antibody
JOT-AP15561-03 100 µL

WWOX(Phospho Tyr33) Polyclonal Antibody

Sign In for Pricing
View Details
Magic™ Human EGFR (d746-750, T790M, L858R) Ba/F3 Cell Line
S01YF-0424-KX79 1 Vial

Magic™ Human EGFR (d746-750, T790M, L858R) Ba/F3 Cell Line

Sign In for Pricing
View Details
NM23A (NME1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI18C12]
TA801300BM 100 µL

NM23A (NME1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI18C12]

Sign In for Pricing
View Details