Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCN5 Peptide - N-terminal region

CLCN5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLCN5, CLCK2

UniProt

P51795

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLCN5 Rabbit Polyclonal Antibody (orb588573) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFLEEPIPGVGTYDDFNTIDWVREKSRDRDRHREITNKSKESTWALIHSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R, S) -Anatabine Tartrate (2:3)
sc-219704 10 mg

(R, S) -Anatabine Tartrate (2:3)

Sign In for Pricing
View Details
LDHA Recombinant Rabbit mAb, BF555 conjugated
orb3164872 100 µL

LDHA Recombinant Rabbit mAb, BF555 conjugated

Sign In for Pricing
View Details
PE-Cy7 human CD33 Antibody
orb3065690-01 25 Tests

PE-Cy7 human CD33 Antibody

Sign In for Pricing
View Details
PE-Cy7 human CD33 Antibody
orb3065690-02 100 Tests

PE-Cy7 human CD33 Antibody

Sign In for Pricing
View Details
Recombinant Human Stem Cell Factor (rHu SCF)
AK9879-0100 100ug

Recombinant Human Stem Cell Factor (rHu SCF)

Sign In for Pricing
View Details
Poliovirus Receptor Related Protein 1 (PVRL1) Magnetic Luminex Assay Kit
LKU606892 96 Tests

Poliovirus Receptor Related Protein 1 (PVRL1) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details