Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCNKB Peptide - C-terminal region

CLCNKB Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLCKB, ClC-K2, ClC-Kb

UniProt

P51801

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLCNKB Rabbit Polyclonal Antibody (orb327437) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VESTESQILVGIVRRAQLVQALKAEPPSWAPGHQQCLQDILAAGCPTEPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UBTD1 siRNA
abx905924-01 15 nmol

Human UBTD1 siRNA

Sign In for Pricing
View Details
Human UBTD1 siRNA
abx905924-02 30 nmol

Human UBTD1 siRNA

Sign In for Pricing
View Details
TCP11 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
46416124 3x 1.0µg DNA

TCP11 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Rhesus Macaque Multi-tissue Tissue MicroArray (Normal)
NBP2-78077 5 Slides

Rhesus Macaque Multi-tissue Tissue MicroArray (Normal)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Beta-1,3-Glucuronyltransferase 1 (b3GAT1)
MBS2147378-01 0.1 mL

APC-Linked Monoclonal Antibody to Beta-1,3-Glucuronyltransferase 1 (b3GAT1)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Beta-1,3-Glucuronyltransferase 1 (b3GAT1)
MBS2147378-02 0.2 mL

APC-Linked Monoclonal Antibody to Beta-1,3-Glucuronyltransferase 1 (b3GAT1)

Sign In for Pricing
View Details