Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCNKB Peptide - C-terminal region

CLCNKB Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLCKB, ClC-K2, ClC-Kb

UniProt

P51801

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLCNKB Rabbit Polyclonal Antibody (orb327437) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VESTESQILVGIVRRAQLVQALKAEPPSWAPGHQQCLQDILAAGCPTEPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MATN1 Mouse mAb
63914 100 µL

MATN1 Mouse mAb

Sign In for Pricing
View Details
AES Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-12392R-BF594 100 µL

AES Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal MDM2/HDM2 Antibody (2G2 2.2) [Janelia Fluor 549]
NBP2-50242JF549 0.1 mL

Mouse Monoclonal MDM2/HDM2 Antibody (2G2 2.2) [Janelia Fluor 549]

Sign In for Pricing
View Details
SR-4 discontinued
394856 200 µL

SR-4 discontinued

Sign In for Pricing
View Details
Bbs12 Mouse shRNA Plasmid (Locus ID 241950)
TL513438 1 Kit

Bbs12 Mouse shRNA Plasmid (Locus ID 241950)

Sign In for Pricing
View Details
OX2 Lentiviral Activation Particles (m)
sc-421696-LAC 200 µL

OX2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details