Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNN1 Peptide - C-terminal region

CNN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CNN1

UniProt

P51911

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNN1 Rabbit Polyclonal Antibody (orb331505) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001290

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitofilin Recombinant Rabbit monoclonal Antibody
HA750694 100 µL

Mitofilin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/2162), CF740 conjugate, 0.1mg/mL
BNC742162-500 1x 500 µL

CD163 (Monocyte & Macrophage Marker) (M130/2162), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L-Serine
TRC-S270995-5G 5 g

L-Serine

Sign In for Pricing
View Details
Mucin-2 Antibody
KC-2511-01 50 μL

Mucin-2 Antibody

Sign In for Pricing
View Details
Mucin-2 Antibody
KC-2511-02 100 µL

Mucin-2 Antibody

Sign In for Pricing
View Details
Mucin-2 Antibody
KC-2511-03 1 mL

Mucin-2 Antibody

Sign In for Pricing
View Details