CNN1 Peptide - C-terminal region
CNN1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CNN1
UniProt
P51911
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CNN1 Rabbit Polyclonal Antibody (orb331505) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001290
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-A825050-25MG 25 mg
3'-Azido-3'-deoxythymidine beta-D-glucuronide, Sodium Salt
Sign In for Pricing
View Details ![YAP1 Recombinant Rabbit monoclonal Antibody [SU33-06]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea829f5/imageurl/et1608-30-50ul.webp)
ET1608-30-50UL 50 µL
YAP1 Recombinant Rabbit monoclonal Antibody [SU33-06]
Sign In for Pricing
View Details ![Protein Z (PROZ) Mouse Monoclonal Antibody [Clone ID: OTI1A11]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907f34/imageurl/cf806740.webp)
CF806740 100 µg
Protein Z (PROZ) Mouse Monoclonal Antibody [Clone ID: OTI1A11]
Sign In for Pricing
View Details 
