Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK2B Peptide - N-terminal region

CSNK2B Peptide - N-terminal region

Product Specifications

Product Name Alternative

G5A, CK2B, CK2N, Ckb1, Ckb2, CSK2B

UniProt

P67870

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSNK2B Rabbit Polyclonal Antibody (orb333743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001311

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptcd1 Mouse shRNA Plasmid (Locus ID 71799)
TL510422 1 Kit

Ptcd1 Mouse shRNA Plasmid (Locus ID 71799)

Sign In for Pricing
View Details
Ack1 inhibitor 2
T85584-01 100 mg

Ack1 inhibitor 2

Sign In for Pricing
View Details
Ack1 inhibitor 2
T85584-02 25 mg

Ack1 inhibitor 2

Sign In for Pricing
View Details
Ack1 inhibitor 2
T85584-03 50 mg

Ack1 inhibitor 2

Sign In for Pricing
View Details
NCI-H1563 Cell Line
CL-0646 1x 10^6 Cells/Vial - 2 Vials

NCI-H1563 Cell Line

Sign In for Pricing
View Details
Olfr536 Protein Vector (Mouse) (pPB-N-His)
PV210827 500 ng

Olfr536 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details