Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK2B Peptide - N-terminal region

CSNK2B Peptide - N-terminal region

Product Specifications

Product Name Alternative

G5A, CK2B, CK2N, Ckb1, Ckb2, CSK2B

UniProt

P67870

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSNK2B Rabbit Polyclonal Antibody (orb333743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001311

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GRK6 Antibody
NBP1-83335 0.1 mL

Rabbit Polyclonal GRK6 Antibody

Sign In for Pricing
View Details
ZNF695 Polyclonal Antibody
E44H03835 100 µL

ZNF695 Polyclonal Antibody

Sign In for Pricing
View Details
Canine Neuron Specific Enolase ELISA Kit
MBS019079-01 48 Well

Canine Neuron Specific Enolase ELISA Kit

Sign In for Pricing
View Details
Canine Neuron Specific Enolase ELISA Kit
MBS019079-02 96 Well

Canine Neuron Specific Enolase ELISA Kit

Sign In for Pricing
View Details
Canine Neuron Specific Enolase ELISA Kit
MBS019079-03 5x 96 Well

Canine Neuron Specific Enolase ELISA Kit

Sign In for Pricing
View Details
Canine Neuron Specific Enolase ELISA Kit
MBS019079-04 10x 96 Well

Canine Neuron Specific Enolase ELISA Kit

Sign In for Pricing
View Details