CYP2E1 Peptide - N-terminal region
CYP2E1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CPE1, CYP2E, P450-J, P450C2E
UniProt
P05181
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CYP2E1 Rabbit Polyclonal Antibody (orb327442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000764
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GA101702 1 Kit
Human GABA A Receptor alpha 6 (GABRA6) activation kit by CRISPRa
Sign In for Pricing
View Details 
![PE/Cyanine7 Anti-Human CD326/EpCAM Antibody[9C4]](https://cdn.genprice.uk/products/763/68dd14a2061270361e7d0e0c/imageurl/e-ab-f1163h.webp)
E-AB-F1163H-01 20 Tests
PE/Cyanine7 Anti-Human CD326/EpCAM Antibody[9C4]
Sign In for Pricing
View Details E-AB-F1163H-02 100 Tests
PE/Cyanine7 Anti-Human CD326/EpCAM Antibody[9C4]
Sign In for Pricing
View Details