Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2E1 Peptide - N-terminal region

CYP2E1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CPE1, CYP2E, P450-J, P450C2E

UniProt

P05181

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP2E1 Rabbit Polyclonal Antibody (orb327442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000764

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAAF11 Mouse Monoclonal Antibody [Clone ID: OTI1D4]
CF806110 100 µg

DNAAF11 Mouse Monoclonal Antibody [Clone ID: OTI1D4]

Sign In for Pricing
View Details
Milbemycin D
TRC-M344290-2.5MG 2.5 mg

Milbemycin D

Sign In for Pricing
View Details
AGO1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G1]
TA811173AM 100 µL

AGO1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G1]

Sign In for Pricing
View Details
Human ZRSR2 activation kit by CRISPRa
GA105451 1 Kit

Human ZRSR2 activation kit by CRISPRa

Sign In for Pricing
View Details
5 (6) -TAMRA C6 maleimide
423-AAT 5 mg

5 (6) -TAMRA C6 maleimide

Sign In for Pricing
View Details
Mouse Ribonucleotide Reductase M1 (RRM1) ELISA Kit
RDR-RRM1-Mu-01 96 Tests

Mouse Ribonucleotide Reductase M1 (RRM1) ELISA Kit

Sign In for Pricing
View Details