CYP11B1 Peptide - N-terminal region
CYP11B1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FHI, CPN1, CYP11B, P450C11
UniProt
P15538
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CYP11B1 Rabbit Polyclonal Antibody (orb327444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001021384
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040096-500 1x 500 µL
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682848-100 1x 100 µL
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402348-500 1x 500 µL
Neurofilament (NF-H) (Neuronal Marker) (rNF421), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details