Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAPK3 Peptide - C-terminal region

DAPK3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DAPK3, ZIPK

UniProt

O43293

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DAPK3 Rabbit Polyclonal Antibody (orb588579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005259565

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leupeptin hemisulfate
sc-295358E 100 mg

Leupeptin hemisulfate

Sign In for Pricing
View Details
CD84 Human Over-expression Lysate
orb1378264 20 µg

CD84 Human Over-expression Lysate

Sign In for Pricing
View Details
USH1C sgRNA CRISPR Lentivector (Human) (Target 3)
K2594804 1.0 µg DNA

USH1C sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PRMT1 (NM_198319) Human Over-expression Lysate
LC405017 20 µg

PRMT1 (NM_198319) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0863 (AF_0863)
MBS7036420-01 0.02 mg

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0863 (AF_0863)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0863 (AF_0863)
MBS7036420-02 0.1 mg

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0863 (AF_0863)

Sign In for Pricing
View Details