Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAPK3 Peptide - C-terminal region

DAPK3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DAPK3, ZIPK

UniProt

O43293

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DAPK3 Rabbit Polyclonal Antibody (orb588579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005259565

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-40 CRISPR/Cas9 KO Plasmid (h)
sc-416221 20 µg

IL-40 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Gallus gallus Allergen Gal d I Protein, N-His
orb2964932-01 50 µg

Recombinant Gallus gallus Allergen Gal d I Protein, N-His

Sign In for Pricing
View Details
Recombinant Gallus gallus Allergen Gal d I Protein, N-His
orb2964932-02 100 µg

Recombinant Gallus gallus Allergen Gal d I Protein, N-His

Sign In for Pricing
View Details
Recombinant Gallus gallus Allergen Gal d I Protein, N-His
orb2964932-03 1 mg

Recombinant Gallus gallus Allergen Gal d I Protein, N-His

Sign In for Pricing
View Details
Hecw1 Rat siRNA Oligo Duplex (Locus ID 291209)
SR509818 1 Kit

Hecw1 Rat siRNA Oligo Duplex (Locus ID 291209)

Sign In for Pricing
View Details
STRM Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV749799 1.0 µg DNA

STRM Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details