Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCTN1 Peptide - C-terminal region

DCTN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DCTN1

UniProt

Q14203

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCTN1 Rabbit Polyclonal Antibody (orb331506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NQO2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61281R-BF350-01 20 µL

NQO2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
NQO2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61281R-BF350-02 100 µL

NQO2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
FIZ1 shRNA Plasmid (m)
sc-145188-SH 20 µg

FIZ1 shRNA Plasmid (m)

Sign In for Pricing
View Details
Caspase-3 Recombinant Rabbit Monoclonal Antibody (PE-Cy7)
orb2353266 100 µL

Caspase-3 Recombinant Rabbit Monoclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
VP37C rabbit pAb
UB-GEN-11135 100 µL

VP37C rabbit pAb

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Alpha-1-Antichymotrypsin (a1ACT)
MBS2050478-01 0.1 mL

APC-Linked Polyclonal Antibody to Alpha-1-Antichymotrypsin (a1ACT)

Sign In for Pricing
View Details