Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCTN1 Peptide - C-terminal region

DCTN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DCTN1

UniProt

Q14203

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCTN1 Rabbit Polyclonal Antibody (orb331506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EHD4 AAV Vector (Human) (CMV)
19054102 1 µg

EHD4 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
ADORA2A sgRNA CRISPR Lentivector (Human) (Target 1)
K0051202 1.0 µg DNA

ADORA2A sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
STAG3 Antibody
C11859-01 50 μL

STAG3 Antibody

Sign In for Pricing
View Details
STAG3 Antibody
C11859-02 100 µL

STAG3 Antibody

Sign In for Pricing
View Details
KMT2C Rabbit Polyclonal Antibody (PE)
orb493209 100 µL

KMT2C Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Thyroglobulin (TG)
MBS2041320-01 0.1 mL

FITC-Linked Polyclonal Antibody to Thyroglobulin (TG)

Sign In for Pricing
View Details