Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPYC Peptide - N-terminal region

EPYC Peptide - N-terminal region

Product Specifications

Product Name Alternative

EPYC, DSPG3, PGLB, SLRR3B

UniProt

Q99645

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPYC Rabbit Polyclonal Antibody (orb327447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004941

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8- (6- Aminohexylthio) guanosine- 5'- O- triphosphate (8-AHT-GTP), sodium salt
A 191-05 5x 1 µmol

8- (6- Aminohexylthio) guanosine- 5'- O- triphosphate (8-AHT-GTP), sodium salt

Sign In for Pricing
View Details
T-Lymphocyte Activation Antigen CD80 (CD80) Antibody
abx455180-01 50 µg

T-Lymphocyte Activation Antigen CD80 (CD80) Antibody

Sign In for Pricing
View Details
T-Lymphocyte Activation Antigen CD80 (CD80) Antibody
abx455180-02 100 µg

T-Lymphocyte Activation Antigen CD80 (CD80) Antibody

Sign In for Pricing
View Details
Calmodulin 3 Rabbit pAb
APA4535-01 30 µL

Calmodulin 3 Rabbit pAb

Sign In for Pricing
View Details
Calmodulin 3 Rabbit pAb
APA4535-02 50 μL

Calmodulin 3 Rabbit pAb

Sign In for Pricing
View Details
Calmodulin 3 Rabbit pAb
APA4535-03 100 µL

Calmodulin 3 Rabbit pAb

Sign In for Pricing
View Details