Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPYC Peptide - N-terminal region

EPYC Peptide - N-terminal region

Product Specifications

Product Name Alternative

EPYC, DSPG3, PGLB, SLRR3B

UniProt

Q99645

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPYC Rabbit Polyclonal Antibody (orb327447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004941

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin-alpha Polyclonal Antibody, PE Conjugated
bs-0159R-PE 100 µL

Tubulin-alpha Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
SARS2 (NM_017827) Human Over-expression Lysate
LH10417V 100 µg

SARS2 (NM_017827) Human Over-expression Lysate

Sign In for Pricing
View Details
MYO9A CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
31303154 3x 1.0 µg DNA

MYO9A CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
MyoD1/Myf3 Antibody (YA3805, Mouse)
HY-P84108-01 10 µL

MyoD1/Myf3 Antibody (YA3805, Mouse)

Sign In for Pricing
View Details
MyoD1/Myf3 Antibody (YA3805, Mouse)
HY-P84108-02 50 μL

MyoD1/Myf3 Antibody (YA3805, Mouse)

Sign In for Pricing
View Details
MyoD1/Myf3 Antibody (YA3805, Mouse)
HY-P84108-03 100 µL

MyoD1/Myf3 Antibody (YA3805, Mouse)

Sign In for Pricing
View Details